Buy PNC-27 Chimeric p53 Peptide Research Material

Every batch ships straight from the lab that synthesises it — sealed, tamper-evident. Buying direct means you pay the lab-direct rate on every vial, with nothing stacked on top.

Order a sealed 10-vial research pack , or add a single-vial laboratory sample alongside your pack to evaluate a compound at smaller scale first. Same source — scaled to whatever your research needs.

Scientific Research Context

What the published literature on PNC-27 examines in cultured cells and in structural work. These are laboratory findings and not claims about the supplied material.

Peptide structure in solution

Two-dimensional NMR was run on the 32-residue sequence in an aqueous environment and in a mixed organic, membrane-mimetic one. In water it showed three alpha-helical domains joined by loops; in the membrane-like solvent the helices lengthened into a U-shaped helix-coil-helix form. [biochemical]

HDM-2 at the cell membrane

A PNAS study reported HDM-2 in the membranes of a variety of cancer cell lines but not in several untransformed lines, and reported PNC-27 colocalising with membrane-bound HDM-2. Untransformed MCF-10-2A cells that were made to express membrane HDM-2 became susceptible to the peptide. [in vitro]

Intact peptide in the membrane

Using a green label at the amino end and a red label at the carboxyl end, MCF-7 cells showed combined yellow punctate fluorescence at 30 minutes, which the authors read as intact peptide. [in vitro]

Pore structure by electron microscopy

Gold-labelled antibodies against PNC-27 and HDM-2 were found in roughly 1:1 ratios in layered ring-shaped structures in pores near the surface of treated cancer cells. No pores were seen in treated untransformed fibroblasts. [in vitro, electron microscopy]

Overview

In short: PNC-27 is a 32-residue chimeric peptide: a 15-residue p53 segment that binds HDM-2, fused to a 17-residue penetratin-type leader.

Key research facts

Defined 32-residue chimera: p53 residues 12-26 followed by a 17-residue leader

Its p53 segment is the HDM-2 binding domain, so the peptide is used to study HDM-2 at the cell membrane

Examined by NMR in water and in membrane-mimetic solvent

Tracked as an intact double-labelled peptide in cell-membrane imaging

A related shorter analogue, PNC-28, gives a comparison point for the leader sequence

These points summarise lab themes, not human outcomes.

The first fifteen residues, Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu, correspond to residues 12 to 26 of p53. The remaining seventeen, Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly, are the membrane residency leader, attached at the carboxyl end. The free peptide has an N-terminal amine and a C-terminal acid.

The cited literature is cell-line, microscopy and structural work. The studies reported that the peptide formed pores in the membranes of the cancer cell lines examined while untransformed lines were reported to be unaffected, and they proposed HDM-2 at the plasma membrane as the target. Several authors of the cited papers declare patents on PNC-27 and PNC-28, and the work has not been summarised here from any independent laboratory. No controlled human data are cited on this page.

New-U Research Compounds supplies PNC-27 as a lyophilised research powder. No analytical report for the supplied material has been published yet, so this page states no purity figure and no certificate. It is for in-vitro and preclinical research only and is not a medicine.

Research class: Chimeric p53-derived cell-penetrating peptide

Structure: p53 residues 12-26 (HDM-2 binding domain) plus 17-residue leader

Evidence base: Cell-line, electron-microscopy, NMR and modelling studies; no controlled human data cited

Proposed Mechanism in the Literature

The authors of the cited work propose that PNC-27 binds HDM-2 sitting in the plasma membrane and that the resulting complexes line transmembrane pores. This is a hypothesis built from imaging and modelling in cell lines.

Pathway Effect Why it matters HDM-2 binding by the p53 segment The 12-26 stretch adopts a conformation that the authors found superimposable on HDM-2-bound p53 The structural basis for proposing HDM-2 as the peptide target Membrane-bound HDM-2 HDM-2 was detected in the membranes of cancer lines tested but not of untransformed lines The proposed reason the reported effect differed between cell types Pore formation Ring-shaped structures with both PNC-27 and HDM-2 labels were seen in pores The proposed route to the membrane disruption and lysis reported in the treated cancer cells Role of the leader Modelling placed the leader pointing away from the 1:1 complex; the authors suggest it may line the pore Left as an open question in the 2022 paper

Deeper dive for scientific readers

The 2022 Biomedicines paper combines conformational energy calculations with immuno-scanning electron microscopy. It reports approximately 1:1 labelling of the two proteins in ring-shaped structures, and it offers two alternative arrangements for how the pore is lined. The 2010 PNAS paper supplies the membrane HDM-2 data. All of this concerns cultured cells; the page makes no statement about behaviour in people.

Common Questions People Are Asking

What is PNC-27?

PNC-27 is a 32-residue chimeric peptide made of p53 residues 12-26, an HDM-2 binding domain, followed by a 17-residue membrane-residency leader. It is supplied here as laboratory research material only.

What does the published research measure?

The cited papers examined the peptide in cultured cell lines, by electron microscopy, by NMR and by modelling. They reported membrane pores in the cancer cell lines tested and none in the untransformed cells used as controls. They are laboratory findings and not claims about the supplied material.

Are there human data?

No controlled human data are cited on this page. The literature referenced here is in-vitro and structural work, so it does not establish safety, effect or intended use in people.

Why is there no molecular weight or formula listed?

None of the sources opened for this page states one, so the page omits them rather than quote an unverified number.

Is there a Certificate of Analysis for PNC-27?

Not yet. No independent analytical report has been published for this material, so no purity figure is quoted.

Is PNC-27 for human use?

No. It is sold for in-vitro and preclinical research only, is not a medicine, and is not for human or veterinary use.

Where can I buy PNC-27?

Right here - PNC-27 is supplied directly by New-U Research Compounds on this page, as lyophilised research-grade material, and shipped direct from source worldwide in discreet, tracked packaging.

How much does PNC-27 cost?

PNC-27 pricing is shown live on this page, per pack size - 10-vial research packs as standard, with single-vial sample options on selected compounds. Larger vial strengths lower the per-mg cost, and shipping is free on orders over $350.

How do I buy PNC-27?

Add the PNC-27 pack size you need to your cart and check out: enter your shipping details, then choose your payment method - cryptocurrency or card - on the next step.

What payment methods can I use to buy PNC-27?

At checkout you can pay by card or crypto. New-U supports BTC and selected stablecoin and network-asset payments across Ethereum, Solana, TRON, Polygon, Base, BNB Chain and Linea. You choose your method after confirming your order.

How fast is shipping, and do you ship worldwide?

Yes - we ship worldwide in discreet, unmarked, tracked packaging; lyophilised peptides are stable through the tracked transit window. Delivery typically takes 6–14 business days, and shipping is free on orders over $350.

Is it legal to buy PNC-27?

In the United States, PNC-27 is sold strictly for laboratory and research purposes only. It is not approved by the FDA for human consumption and is not sold for that purpose. Regulatory status varies by jurisdiction - buyers are responsible for compliance in their own region.

Research use only - all claims made on this site are for testing and research use only.

Pharmacokinetics

Stability Lyophilised powder: store in freezer (−20 °C). Reconstituted: refrigerate 1–6 °C, away from sunlight. Notes Laboratory research material. No amount, schedule or administration guidance is published or recommended on this page.

Evidence Tier

Overall: Tier 3: Limited / anecdotal

The cited record is preclinical: cultured cell lines, electron microscopy, NMR spectroscopy and computational modelling, largely from a small set of connected research groups, some of whose authors declare patents on the peptide. No controlled human data are cited. The tier describes the literature, not the supplied material, for which no analytical report has been published yet.

Databases & peer-reviewed sources

Last reviewed: 13 October 2026 · New-U Research Compounds

Sarafraz-Yazdi E, Mumin S, Cheung D, et al. PNC-27, a Chimeric p53-Penetratin Peptide Binds to HDM-2 in a p53 Peptide-like Structure, Induces Selective Membrane-Pore Formation and Leads to Cancer Cell Lysis. Biomedicines 2022. · 2022 · PMID: 35625682 · DOI: 10.3390/biomedicines10050945

Sarafraz-Yazdi E, Bowne WB, Adler V, et al. Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes. Proc Natl Acad Sci U S A 2010. · 2010 · PMID: 20080680 · DOI: 10.1073/pnas.0909364107

Sookraj KA, Bowne WB, Adler V, et al. The anti-cancer peptide, PNC-27, induces tumor cell lysis as the intact peptide. Cancer Chemother Pharmacol 2010. · 2010 · PMID: 20182728 · DOI: 10.1007/s00280-009-1166-7

Rosal R, Pincus MR, Brandt-Rauf PW, et al. NMR solution structure of a peptide from the mdm-2 binding domain of the p53 protein that is selectively cytotoxic to cancer cells. Biochemistry 2004. · 2004 · PMID: 14967026 · DOI: 10.1021/bi035718g

PubMed: peer-reviewed literature on PNC-27

ClinicalTrials.gov: registered studies on PNC-27

PNC-27: Wikipedia (search)

WebMD: consumer health reference

BBC News: Health

CNN Health: “Peptides: what to know about the wellness trend”

Sky News: “Can peptides make America healthy again?”

Sky News: “Inside the exploding US peptides craze” (video)

Sky News Australia: “Black market peptide trade explodes as influencers fuel uptick in use”

Sky News Australia: “Backyard peptide boom sparks alarm” (video)

Sky News Australia: “Oprah reveals struggle with shame of weight-loss drugs”

Key Characteristics

32 residues: p53 12-26 (15 residues) plus a 17-residue leader

Free N-terminal amine and C-terminal acid

Studied in cultured cells, by NMR, by electron microscopy and by modelling

No controlled human data cited; no amount or schedule guidance on this page

Supplied as 10-vial packs of 5 or 10 mg vials, with single-vial samples; no analytical report published yet

Specifications

Sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG (32 residues) p53 segment Residues 1-15 (p53 12-26) Leader Residues 16-32, membrane residency peptide Form Lyophilised powder Pack 10 vials × 5 mg or 10 mg; single-vial samples available Analytical report None published yet Storage Lyophilised: −20 °C freezer. Reconstituted: 1-6 °C, away from light.

About PNC-27: Chimeric p53 Peptide Research Guide

PNC-27 was first characterised structurally in 2004, when two-dimensional NMR on the 32-residue sequence described amphipathic structures in both aqueous and membrane-like solvent. Later work moved to cells: the 2010 PNAS paper tied the reported effect to HDM-2 in the plasma membrane, and the 2022 Biomedicines paper used electron microscopy to look at the pores themselves.

Nothing in that record establishes an effect, a safe amount or a use in people, and this page does not suggest one. Several authors of the cited studies declare patents on the peptide, and the studies were run on cell lines and in vitro systems.

New-U Research Compounds supplies PNC-27 as a lyophilised research powder in sealed 10-vial packs of 5 or 10 mg vials, with single-vial samples. No analytical report for the supplied material has been published yet, and this page makes no purity or certificate claim. It is for in-vitro and preclinical research only, and nothing here is medical advice.

Sarafraz-Yazdi et al., Biomedicines 2022 (PubMed 35625682)

Sarafraz-Yazdi et al., Proc Natl Acad Sci U S A 2010 (PubMed 20080680)

Sookraj et al., Cancer Chemother Pharmacol 2010 (PubMed 20182728)

Rosal et al., Biochemistry 2004 (PubMed 14967026)

Customer Reviews

No customer reviews yet - be the first to share your experience.

More in Metabolic / Longevity

Metabolic / Longevity MOTS-C MOTS-c mitochondrial-derived peptide activates AMPK via folate-AICAR pathway to regulate glucose metabolism, insulin sensitivity, and lipid oxidation. MOTS-C →

Metabolic / Longevity 5-Amino-1MQ 5-Amino-1MQ is a selective NNMT inhibitor that preserves intracellular NAD+ and SAM pools by blocking nicotinamide methylation in adipose tissue. 5-Amino-1MQ →

Metabolic / Longevity Epitalon Epitalon (AEDG) is a synthetic tetrapeptide telomerase activator that upregulates hTERT expression to elongate telomeres in human somatic cells. Epitalon →

Metabolic / Longevity FOXO4-DRI FOXO4-DRI is a D-retro-inverso senolytic peptide that disrupts the FOXO4-p53 nuclear interaction to selectively induce apoptosis in senescent cells. FOXO4-DRI →

Metabolic / Longevity SS-31 SS-31 (Elamipretide) is a mitochondria-targeted tetrapeptide that concentrates in the inner mitochondrial membrane, binds cardiolipin, and restores electron transport chain efficiency in models of mitochondrial dysfunction. SS-31 →

Metabolic / Longevity Cartalax Cartalax (Ala-Glu-Asp / AED) is a synthetic short-peptide bioregulator from the Khavinson cytogen family, studied for tissue-specific gene modulation in cartilage and connective-tissue cell cultures. Cartalax →

PNC-27 vs related Metabolic / Longevity compounds

Compound Price Purity spec COA PNC-27 from $245 Not published On request MOTS-C from $103 >99% HPLC 2 published batches 5-Amino-1MQ from $93 >99% HPLC On request

Descriptive catalog comparison for research sourcing decisions - not dosing guidance.

More on PNC-27

Metabolic Research research compounds

PNC-27 research guide

Research this compound

Research guide PNC-27 research guide The authors of the cited work propose that PNC-27 binds HDM-2 sitting in the plasma membrane and that the resulting complexes line… Read the guide →

From our community

What people say on Facebook

PRECISION. PURITY. PERFORMANCE.

Research peptides. Third-party Certificates of Analysis (Janoshik Analytical & Freedom Diagnostics) are published on the website. Supplied strictly for laboratory research use.

Shop

All research compounds

Price list

Where to buy peptides

Research