Buy IGF-1 LR3
Also known as Long R3 IGF-1, Long Arginine 3 IGF-1, LR3-IGF-1, Insulin-Like Growth Factor 1 Long R3, LONG R3 IGF-I, Recombinant Long R3 IGF-1
IGF-1 LR3, 83-amino acid extended IGF-1 analogue with Arg3 substitution eliminating IGFBP binding for 3-fold enhanced potency and 20–30 hour half-life.
Why buy IGF-1 LR3 from New-U Research Compounds
- >99% HPLC purity — every batch independently verified by Janoshik Analytics & Freedom Diagnostics, with a batch-linked Certificate of Analysis
- 10-vial research packs — a full research supply per compound, not single vials
- Direct-from-source pricing — no middleman markup
- 6–14-day worldwide delivery — direct from source, discreet, cold-chain worldwide
- Free shipping over $300 — card and cryptocurrency accepted
- Trusted by 10,000+ researchers worldwide
What is IGF-1 LR3?
IGF-1 LR3 (Long Arginine 3 IGF-1) is an 83-amino-acid recombinant IGF-1 analog engineered to escape IGF-binding protein sequestration, giving it roughly 3× the potency and a 20-30 hour half-life of native IGF-1.
IGF-1 LR3 activates the IGF-1 receptor directly - driving protein synthesis, cell proliferation, and glucose uptake - without getting trapped by circulating IGF-binding proteins.
IGF-1 LR3 at a glance
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
|---|---|
| Molecular weight | 9,117.5 Da |
| Purity | >99% HPLC |
| Form | Lyophilised powder |
| Category | Muscle / Performance |
| Storage | Lyophilised powder: store in freezer (−20 °C). Reconstituted: refrigerate 1–6 °C, away from sunlight. Use within the validated stability window for the specific batch and formulation. |
IGF-1 LR3 pricing
| Research pack | Per vial | Price |
|---|---|---|
| 10 vials | 0.1mg | $90 |
| 10 vials | 1mg | $240 |
All packs are >99% HPLC research-grade material. Free shipping on orders over $300.
Frequently asked questions
Where can I buy IGF-1 LR3?
IGF-1 LR3 (also known as Long R3 IGF-1) is available directly from New-U Research Compounds at https://new-u.io/peptide/igf-1-lr3. Every batch is independently third-party tested by Janoshik Analytics and Freedom Diagnostics to >99% HPLC purity, supplied as lyophilised research-grade material, and shipped direct from source worldwide (approximately 6–14 business days).
How much does IGF-1 LR3 cost?
IGF-1 LR3 starts at $90 for a 10-vial research pack (0.1mg per vial) at New-U Research Compounds, with 2 pack sizes available. Orders over $300 ship free.
Is New-U IGF-1 LR3 third-party tested?
Yes. Every IGF-1 LR3 batch is verified by independent laboratories (Janoshik Analytics and Freedom Diagnostics) for identity and purity, with a batch-linked Certificate of Analysis confirming >99% purity by HPLC area normalisation.
How fast does IGF-1 LR3 ship, and do you ship internationally?
IGF-1 LR3 ships direct from source, discreetly worldwide with cold-chain handling where required. Delivery is approximately 6–14 business days worldwide. Shipping is free on orders over $300. Card and cryptocurrency payments are accepted.
Is it legal to buy IGF-1 LR3?
In the United States, IGF-1 LR3 is sold strictly for laboratory and research purposes only. It is not approved by the FDA for human consumption and is not sold for that purpose. Regulatory status varies by jurisdiction — buyers are responsible for compliance in their own region.
What is IGF-1 LR3 used for in research?
IGF-1 LR3, 83-amino acid extended IGF-1 analogue with Arg3 substitution eliminating IGFBP binding for 3-fold enhanced potency and 20–30 hour half-life. New-U supplies IGF-1 LR3 as research-grade reference material for laboratory and in-vitro or animal-model investigation only. Mechanism, pharmacokinetics and study context are summarised on the IGF-1 LR3 research profile. Not for human use.
What is the typical IGF-1 LR3 research dosage?
Reconstitution volumes and dosing reported in the literature for IGF-1 LR3 are described in research-model terms only. New-U Research Compounds supplies IGF-1 LR3 strictly for laboratory research and does not provide human-use dosing guidance. Reconstitution math and study-reported ranges are covered on the full research profile.
Can I buy IGF-1 LR3 online and how fast does it ship?
Yes. IGF-1 LR3 can be ordered online directly from New-U Research Compounds with card or cryptocurrency, shipped direct from source discreetly worldwide. Delivery is approximately 6–14 business days worldwide. Free shipping applies to orders over $300.
Can I buy IGF-1 LR3 in bulk?
IGF-1 LR3 ships in 10-vial research packs as standard, in 2 pack sizes — the larger mg vials lower the per-mg cost. Multi-pack orders get direct-from-source pricing and free shipping over $300. For wholesale or recurring laboratory-supply volumes, contact New-U Research Compounds at https://new-u.io/contact.
What should I look for when choosing where to buy IGF-1 LR3?
For research-grade IGF-1 LR3, verify four things: (1) independent third-party purity testing with a batch-linked Certificate of Analysis — New-U uses Janoshik Analytics and Freedom Diagnostics at >99% HPLC; (2) lyophilised material with documented storage and handling; (3) transparent direct-from-source pricing rather than marketplace markup; and (4) clear research-use-only framing. New-U Research Compounds meets all four at https://new-u.io/peptide/igf-1-lr3.
What is IGF-1 LR3?
IGF-1 LR3 (Long R3 Insulin-like Growth Factor-1) is an 83-amino-acid analogue of human IGF-1 with an N-terminal extension and an Arg substitution at position 3. Those modifications stop it binding IGF-binding proteins, greatly extending its active half-life versus native IGF-1. It is supplied as a lyophilised research-grade powder for laboratory use only.
What does IGF-1 LR3 do?
In research models IGF-1 LR3 activates the IGF-1 receptor (and PI3K/Akt and MAPK signalling) to drive cell growth, proliferation, differentiation and survival — with a much longer duration of action than native IGF-1 because it evades IGFBP sequestration. These are findings in cell and animal models; New-U supplies it for laboratory research only and implies no human effect.
What is IGF-1 LR3 used for?
IGF-1 LR3 is widely used as a cell-culture supplement to support proliferation and survival of cultured cells, and as a research tool for studying IGF-1-receptor signalling, hypertrophy and tissue-growth endpoints. New-U supplies it strictly for in-vitro and laboratory research; it is not for human use.
Does IGF-1 LR3 show up on a drug test?
Standard employment or clinical drug panels (including typical LabCorp steroid panels) do not screen for IGF-1 LR3 — it is a peptide, not a small-molecule steroid, and requires specialised assays. It is, however, on the WADA Prohibited List, and anti-doping authorities use dedicated tests for IGF-1 analogues. New-U supplies IGF-1 LR3 for laboratory research only, not for human or athletic use.
What does "LR3" actually mean?
"L" for the 13-amino-acid N-terminal extension (MFPAMPLSSLFVN), "R" for arginine, and "3" for position 3 of the IGF-1 sequence. So "LR3" literally means "the Long variant with an Arginine at position 3". Both modifications are needed to eliminate IGFBP binding and extend circulating half-life.
How is IGF-1 LR3 different from IGF-1 DES?
IGF-1 DES is the opposite end of the design spectrum - a truncated 67-residue form missing the N-terminal tripeptide GPE, which also dramatically reduces IGFBP binding. IGF-1 LR3 uses a 13-residue extension to achieve similar IGFBP resistance. LR3 has a much longer half-life (20-30 h vs minutes); DES produces more intense, shorter-duration local effects when injected site-specifically.
Why is IGF-1 LR3 used in cell culture?
Native IGF-1 is inefficient in cell culture because IGFBPs produced by the cells themselves can sequester it, reducing effective concentrations. IGF-1 LR3 escapes that sequestration and delivers consistent, reproducible growth-factor signalling. That is why it is an industry standard for bioprocessing and mammalian cell culture.
How should IGF-1 LR3 be stored?
Keep the lyophilised powder frozen at −20 °C. After reconstitution with bacteriostatic water, refrigerate at 1-6 °C and protect from light. IGF-1 LR3 is a structured protein and is sensitive to repeated freeze-thaw cycles - aliquot if you need multiple doses from one reconstitution.
Research references
Independent literature and reference sources for IGF-1 LR3. Provided for scientific context — New-U Research Compounds supplies research-use-only material.
Looking for mechanism of action, pharmacokinetics, dosage ranges and source references? See the full IGF-1 LR3 research profile.